PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.F01914.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family NAC
Protein Properties Length: 378aa    MW: 42628.9 Da    PI: 5.1445
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.F01914.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM164.15.1e-51211481128
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                       l+pGfrFhPtdeelv +yL++k+ +k++++ e+++e+d+yk+ePw++ +  ++k+++ ewyfFs+ d+ky +g+r nrat +gyWkatgkd+ 
  Migut.F01914.1.p  21 LAPGFRFHPTDEELVRYYLRRKACRKPFRF-EAVSEIDVYKSEPWEIAEysSTKSRDLEWYFFSPVDRKYGNGSRLNRATGQGYWKATGKDRY 112
                       579*************************99.89**************84235555666*********************************** PP

               NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       v + k++++g+kktLvf++grap+g++t+Wvmheyrl
  Migut.F01914.1.p 113 VRH-KDQTIGMKKTLVFHSGRAPDGKRTNWVMHEYRL 148
                       ***.8999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.55E-6114171IPR003441NAC domain
PROSITE profilePS5100556.66821171IPR003441NAC domain
PfamPF023655.3E-2823148IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 378 aa     Download sequence    Send to blast
MGHEVAAAAG GGTVAAAATC LAPGFRFHPT DEELVRYYLR RKACRKPFRF EAVSEIDVYK  60
SEPWEIAEYS STKSRDLEWY FFSPVDRKYG NGSRLNRATG QGYWKATGKD RYVRHKDQTI  120
GMKKTLVFHS GRAPDGKRTN WVMHEYRLCD SELEMAGVSQ EAFVLCRIFQ KSGLGPPNGN  180
RYAPFVEEEW DDDDDMALVV PGGEPDDDVA NGDEARVLDQ ETQPLRIAMG PATTTIPFTC  240
KRERSDGPDP LTLSPTKRSK LEDPISNGSE DSTTTSQDPP PATTLNMMMT KKVVSLEFPL  300
FEEPPNENNK FDSSNLEKSV PPGYLKFINN LEKEMMNVSM DRESLKIEVM RAQAIINYLQ  360
SRVDLLTREN EDLRKRV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B9e-492117117165NAC domain-containing protein 19
4dul_A9e-492117117165NAC domain-containing protein 19
1ut7_B9e-492117117165NO APICAL MERISTEM PROTEIN
1ut7_A9e-492117117165NO APICAL MERISTEM PROTEIN
1ut4_B9e-492117117165NO APICAL MERISTEM PROTEIN
1ut4_A9e-492117117165NO APICAL MERISTEM PROTEIN
3swp_D1e-482117120168NAC domain-containing protein 19
3swp_C1e-482117120168NAC domain-containing protein 19
3swp_B1e-482117120168NAC domain-containing protein 19
3swp_A1e-482117120168NAC domain-containing protein 19
3swm_D1e-482117120168NAC domain-containing protein 19
3swm_C1e-482117120168NAC domain-containing protein 19
3swm_B1e-482117120168NAC domain-containing protein 19
3swm_A1e-482117120168NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012834785.10.0PREDICTED: NAC domain-containing protein 53-like
TrEMBLA0A068TWS90.0A0A068TWS9_COFCA; Uncharacterized protein
STRINGPGSC0003DMT4000797910.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31402448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10480.22e-90NAC domain containing protein 50